Antibody data

Product number
H00027299-M03
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00027299-M03, RRID:AB_1112479
Product name
ADAMDEC1 monoclonal antibody (M03), clone 1G2
Provider product page
Abnova Corporation - H00027299-M03
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant ADAMDEC1.
Antigen sequence
PDVPFNTKCPSGSCVMNQYLSSKFPKDFSTSCRAH
FERYLLSQKPKCLLQAPIPTNIMTTPVCGNHLLEV
GEDCDCGSPKECTNLCCEALTCKLKPGTDCGGDAP
NHTTE
Isotype
IgG
Antibody clone number
1G2
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -