HPA028317

ADAMDEC1 antibody from Sigma-Aldrich
M12.219
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA028317
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA028317, RRID:AB_10601963
Product name
Anti-ADAMDEC1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA028317
Antibody type
Polyclonal
Antigen
ADAM-like, decysin 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
IKQTPELTLHEIVCPKKLHILHKREIKNNQTEKHG
KEERYEPEVQYQMILNGEEIILSLQKTKHLLGPDY
TETLYSPRG
Storage
-20C
Provider Type Product Number
- No reagents -