HPA009173

CDHR5 antibody from Atlas Antibodies
FLJ20219, MU-PCDH, MUCDHL, MUPCDH
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA009173
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA009173, RRID:AB_1079429
Product name
Anti-CDHR5
Provider product page
Atlas Antibodies - HPA009173
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
CSVNKDIFEVEENTNVTEPLVDIHVPEGQEVTLGA
LSTPFAFRIQGNQLFLNVTPDYEEKSLLEAQLLCQ
SGGTLVTQLRVFVSVLDVNDNAPEFPFKTKEIRVE
EDTKVNSTVIPETQLQAEDRDKDDILFYTLQEMTA
GASDYFSLVS
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -