HPA009081

CDHR5 antibody from Sigma-Aldrich
FLJ20219, MU-PCDH, MUCDHL, MUPCDH
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA009081
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA009081, RRID:AB_1079428
Product name
Anti-MUCDHL antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA009081
Antibody type
Polyclonal
Antigen
Mucin and cadherin-like protein precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
CIQAQYHGAVPTGHILPSPLVLRPGPIYAEDGDRG
INQPIIYSIFRGNVNGTFIIHPDSGNLTVARSVPS
PMTFLLLVKGQQADLARYSVTQVTVEAVAAAGSPP
RFPQSLYRGTVARGAGAGVVVKDA
Storage
-20C
Provider Type Product Number
- No reagents -