HPA009173

CDHR5 antibody from Sigma-Aldrich
FLJ20219, MU-PCDH, MUCDHL, MUPCDH
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA009173
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA009173, RRID:AB_1079429
Product name
Anti-MUCDHL antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA009173
Antibody type
Polyclonal
Antigen
Mucin and cadherin-like protein precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
CSVNKDIFEVEENTNVTEPLVDIHVPEGQEVTLGA
LSTPFAFRIQGNQLFLNVTPDYEEKSLLEAQLLCQ
SGGTLVTQLRVFVSVLDVNDNAPEFPFKTKEIRVE
EDTKVNSTVIPETQLQAEDRDKDDILFYTLQEMTA
GASDYFSLVS
Storage
-20C
Provider Type Product Number
- No reagents -