HPA013154

DNAJC5 antibody from Sigma-Aldrich
CLN4, DNAJC5A, FLJ00118, FLJ13070
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA013154
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA013154, RRID:AB_1847292
Product name
Anti-DNAJC5 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA013154
Antibody type
Polyclonal
Antigen
DnaJ homolog subfamily C member 5 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MADQRQRSLSTSGESLYHVLGLDKNATSDDIKKSY
RKLALKYHPDKNPDNPEAADKFKEINNAHAILTDA
T
Storage
-20C
Provider Type Product Number
- No reagents -