HPA008879

ADAM7 antibody from Sigma-Aldrich
EAPI, GP-83
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008879
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008879, RRID:AB_10601789
Product name
Anti-ADAM7 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008879
Antibody type
Polyclonal
Antigen
ADAM metallopeptidase domain 7 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LGVEGQQLVRPKKLPLIQKRDTGHTHDDDILKTYE
EELLYEIKLNRKTLVLHLLRSREFLGSNYSETFYS
MKGEAFTRHPQIMDHCFYQGSIVHEYDSAASISTC
NGLRGFFRINDQRYLIEPVKYSDEGEHLVFKYNLR
VPYGANYS
Storage
-20C
Provider Type Product Number
- No reagents -