PAB22413

SLC25A1 antibody from Abnova Corporation
CTP, SLC20A3

Antibody data

Product number
PAB22413
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB22413, RRID:AB_10963492
Product name
SLC25A1 polyclonal antibody
Provider product page
Abnova Corporation - PAB22413
Antibody type
Polyclonal
Antigen
Recombinant protein corresponding to amino acids of human SLC25A1.
Reactivity
Human
Host
Rabbit
Antigen sequence
ETIKVKFIHDQTSPNPKYRGFFHGVREIVREQGLK
GTYQGLTATVLKQGSNQAIRFFVMTSLRNWYRGDN
PNKPMNP
Isotype
IgG
Vial size
100 µl
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -