Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA041186 - Provider product page
- Provider
- Atlas Antibodies
- Product name
- Anti-CCDC78
- Antibody type
- Polyclonal
- Antigen
- Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
KLKDEYVLRLQHCAWQAVEHADGAGQAPATTALRT
FLEATLEDIRAAHRSREQQLARAARSYHKRLVDLS
RRHEELLVAYRAPGNPQAIFDIASLDLEPLPVPL- Isotype
- IgG
- Vial size
- 100μl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Centriole amplification by mother and daughter centrioles differs in multiciliated cells
MCIDAS mutations result in a mucociliary clearance disorder with reduced generation of multiple motile cilia
Al Jord A, Lemaître A, Delgehyr N, Faucourt M, Spassky N, Meunier A
Nature 2014;516(7529):104-107
Nature 2014;516(7529):104-107
MCIDAS mutations result in a mucociliary clearance disorder with reduced generation of multiple motile cilia
Boon M, Wallmeier J, Ma L, Loges N, Jaspers M, Olbrich H, Dougherty G, Raidt J, Werner C, Amirav I, Hevroni A, Abitbul R, Avital A, Soferman R, Wessels M, O’Callaghan C, Chung E, Rutman A, Hirst R, Moya E, Mitchison H, Van Daele S, De Boeck K, Jorissen M, Kintner C, Cuppens H, Omran H
Nature Communications 2014;5(1)
Nature Communications 2014;5(1)
No comments: Submit comment
No validations: Submit validation data