Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN404944 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-BTB (POZ) Domain Containing 2 (BTBD2) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-BTBD2 antibody: synthetic peptide directed towards the N terminal of human BTBD2
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Xenopus
- Host
- Rabbit
- Antigen sequence
AFLFNNEVLCDVHFLVGKGLSSQRIPAHRFVLAVG
SAVFD AMFNGGMATT- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references A human protein-protein interaction network: a resource for annotating the proteome.
Stelzl U, Worm U, Lalowski M, Haenig C, Brembeck FH, Goehler H, Stroedicke M, Zenkner M, Schoenherr A, Koeppen S, Timm J, Mintzlaff S, Abraham C, Bock N, Kietzmann S, Goedde A, Toksöz E, Droege A, Krobitsch S, Korn B, Birchmeier W, Lehrach H, Wanker EE
Cell 2005 Sep 23;122(6):957-68
Cell 2005 Sep 23;122(6):957-68
No comments: Submit comment
No validations: Submit validation data