HPA009285

CD276 antibody from Sigma-Aldrich
B7-H3, B7H3, B7RP-2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA009285
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA009285, RRID:AB_1078258
Product name
Anti-CD276 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA009285
Antibody type
Polyclonal
Antigen
CD276 antigen precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
YSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEV
FWQDGQGVPLTGNVTTSQMANEQGLFDVHSVLRVV
LGANGTYSCLVRNPVLQQDAHGSVTITGQP
Storage
-20C
Provider Type Product Number
- No reagents -