Antibody data
- Product number
- HPA017139
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA017139, RRID:AB_1845246
- Product name
- Anti-CD276
- Provider product page
- Atlas Antibodies - HPA017139
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
EVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLN
LIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDL
LAQGNASLRLQRVRVADEGSFTCFVSIRDFG
- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Costimulatory Protein 4IgB7H3 Drives the Malignant Phenotype of Glioblastoma by Mediating Immune Escape and Invasiveness
Lemke D, Pfenning P, Sahm F, Klein A, Kempf T, Warnken U, Schnolzer M, Tudoran R, Weller M, Platten M, Wick W
Clinical Cancer Research 2012 January;18(1):105-117
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Western blot analysis in human cell line RT-4 and human cell line U-251 MG.
Enhanced validation
- Submitted by
-
Atlas Antibodies (provider)
- Enhanced method
- Recombinant expression validation
- Main image

- Experimental details
- Western blot analysis in control (vector only transfected HEK293T lysate) and CD276 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY410803).
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunofluorescent staining of human cell line A-431 shows localization to vesicles.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human prostate shows membranous positivity in glandular cells.
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human placenta shows high expression.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human pancreas shows low expression as expected.
- Sample type
- HUMAN
Enhanced validation
- Submitted by
-
Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image

- Experimental details
- Immunohistochemistry analysis in human placenta and pancreas tissues using Anti-CD276 antibody. Corresponding CD276 RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
- Orthogonal method
- Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
- Show more