HPA009410

FAM189A1 antibody from MilliporeSigma / Merck KGaA
KIAA0574, TMEM228
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA009410
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA009410, RRID:AB_1852332
Product name
Anti-AC024474.8 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA009410
Antibody type
Polyclonal
Antigen
Transmembrane protein KIAA0574 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PGMGSQVQPGPGHVSRSTSDPTLCTSSMAGDASSH
RPSCSQDLEAGLSEAVPGSASMSRSATAACRAQLS
PAGDPDTWKTDQRPTPEPFPATSKERPRSLVDSKA
YADARV
Storage
-20C
Provider Type Product Number
- No reagents -