Antibody data

Product number
ABIN311142
Provider
antibodies-online
Product name
anti-UDP Glycosyltransferase 3 Family, Polypeptide A2 (UGT3A2) (N-Term) antibody
Provider product page
antibodies-online - ABIN311142
Antibody type
Polyclonal
Antigen
The immunogen for anti-UGT3A2 antibody: synthetic peptide directed towards the N terminal of human UGT3A2
Description
Protein A purified
Reactivity
Human, Canine
Host
Rabbit
Antigen sequence
HNVTMLNHKRGPFMPDFKKEEKSYQVISWLAPEDH
QREFK KSFDFFLEET
Epitope
N-Term
Vial size
100 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -