HPA019252

DEFB129 antibody from Sigma-Aldrich
bA530N10.3, C20orf87, DEFB-29
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019252
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019252, RRID:AB_10601207
Product name
Anti-DEFB129 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019252
Antibody type
Polyclonal
Antigen
defensin, beta 129 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
CCVGPKVVKLIKNYLQYGTPNVLNEDVQEMLKPAK
NSSAVIQRKHILSVLPQIKSTSFFANTNFVIIPNA
TPMNSATISTMTPGQITYTATSTKSNTKESRDSAT
ASPPPAPPPPNILPTPSLEL
Storage
-20C
Provider Type Product Number
- No reagents -