HPA009413

JPH1 antibody from Sigma-Aldrich
JP-1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA009413
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA009413, RRID:AB_1079163
Product name
Anti-JPH1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA009413
Antibody type
Polyclonal
Antigen
Junctophilin-1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PQSKYSGRHHIPNPSNGELHSQYHGYYVKLNAPQH
PPVDVEDGDGSSQSSSALVHKPSANKWSPSKSVTK
PVAKESKAEPKAKKSELAIPKNPASNDSCPAL
Storage
-20C
Provider Type Product Number
- No reagents -