Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN643496 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Adaptor-Related Protein Complex 3, delta 1 Subunit (AP3D1) antibody
- Antigen
- Synthetic peptide derived from human AMH (VPTAYAGKLLISLSEERISAHHVPNMVATEC)
- Reactivity
- Human
- Host
- Mouse
- Isotype
- IgG
- Vial size
- 0.1 ml
- Storage
- Store at +4 ° C or at -20 ° C if preferred. This product should be stored undiluted. Storage in frost-free freezers is not recommended. Avoid repeated freezing and thawing as this may denature the antibody. Should this product contain a precipitate we recommend microcentrifugation before use. Shelf Life: 18 months from date of shipment
No comments: Submit comment
No validations: Submit validation data