P3126-25
antibody from United States Biological
Targeting: PDS5B
APRIN, AS3, CG008, FLJ23236, KIAA0979
Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- P3126-25 - Provider product page

- Provider
- United States Biological
- Product name
- PDS5, Regulator of Cohesion Maintenance, Homolog B (PDS5B, APRIN, CG008, FLJ23236, KIAA0979, RP1-267P19.1)
- Antibody type
- Monoclonal
- Antigen
- Partial sequence of recombinant full-length protein to human PDS5, Regulator of Cohesion Maintenance, Homolog B consisting of amino acids from the C-terminal portion of the protein (Sequence: QWPEEKRLKEDILENEDEQNSPPKKGKRGRPPKPLGGGTPKEEPTMKTSKKGSKKKSGPPAPEEEEEEERQSGNTEQKSKSKQHRVSRRAQQRAESPESSAIESTQSTPQKGRGRPSKTPSP)
- Description
- Purified by Protein G affinity chromatography.
- Reactivity
- Human
- Host
- Mouse
- Isotype
- IgG
- Antibody clone number
- 8C261
- Vial size
- 50µg
- Concentration
- ~0.1mg/ml
- Storage
- 4°C/-20°C
No comments: Submit comment
No validations: Submit validation data