Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00000665-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00000665-M01, RRID:AB_489914
- Product name
- BNIP3L monoclonal antibody (M01), clone 3G2
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant BNIP3L.
- Antigen sequence
SSNGNDNGNGKNGGLEHVPSSSSIHNGDMEKILLD
AQHESGQSSSRGSSHCDSPSPQEDGQIMFDVEMHT
SRDHSSQSEEEVVEGEKE- Isotype
- IgG
- Antibody clone number
- 3G2
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references BNIP3 and NIX mediate Mieap-induced accumulation of lysosomal proteins within mitochondria.
Identification of 14-3-3γ as a Mieap-interacting protein and its role in mitochondrial quality control.
Nakamura Y, Kitamura N, Shinogi D, Yoshida M, Goda O, Murai R, Kamino H, Arakawa H
PloS one 2012;7(1):e30767
PloS one 2012;7(1):e30767
Identification of 14-3-3γ as a Mieap-interacting protein and its role in mitochondrial quality control.
Miyamoto T, Kitamura N, Ono M, Nakamura Y, Yoshida M, Kamino H, Murai R, Yamada T, Arakawa H
Scientific reports 2012;2:379
Scientific reports 2012;2:379
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged BNIP3L is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to BNIP3L on HeLa cell . [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol