Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- ELISA [1]
- Immunoprecipitation [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00000665-M02 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00000665-M02, RRID:AB_10551494
- Product name
- BNIP3L monoclonal antibody (M02), clone 2E11
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant BNIP3L.
- Antigen sequence
SSNGNDNGNGKNGGLEHVPSSSSIHNGDMEKILLD
AQHESGQSSSRGSSHCDSPSPQEDGQIMFDVEMHT
SRDHSSQSEEEVVEGEKE- Isotype
- IgG
- Antibody clone number
- 2E11
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged BNIP3L is 0.3 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoprecipitation of BNIP3L transfected lysate using anti-BNIP3L monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with BNIP3L MaxPab rabbit polyclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol