HPA015652

BNIP3L antibody from Sigma-Aldrich
BNIP3a, Nix
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA015652
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA015652, RRID:AB_1845406
Product name
Anti-BNIP3L antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA015652
Antibody type
Polyclonal
Antigen
BCL2/adenovirus E1B 19 kDa protein-interacting protein 3-like recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SNGNDNGNGKNGGLEHVPSSSSIHNGDMEKILLDA
QHESGQSSSRGSSHCDSPSPQEDGQIMFDVEMHTS
RDHSSQSEEEVVEGEKEVEALKKSADWVSDWSSRP
ENIPPKEFHFRHPKRSVSLSMRKSGAMK
Storage
-20C
Provider Type Product Number
- No reagents -