HPA027564

NKX3-2 antibody from Atlas Antibodies
BAPX1, NKX3.2, NKX3B
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA027564
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA027564, RRID:AB_10601973
Product name
Anti-NKX3-2
Provider product page
Atlas Antibodies - HPA027564
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
PKPRKKRSRAAFSHAQVFELERRFNHQRYLSGPER
ADLAASLKLTETQVKIWFQNRRYKTKRRQMAADLL
ASAPAAKKVAVKVLVRDDQRQYLPGEVLRPPSLLP
LQPSYYYPYY
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -