HPA027564

NKX3-2 antibody from Sigma-Aldrich
BAPX1, NKX3.2, NKX3B
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA027564
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA027564, RRID:AB_10601973
Product name
Anti-NKX3-2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA027564
Antibody type
Polyclonal
Antigen
NK3 homeobox 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PKPRKKRSRAAFSHAQVFELERRFNHQRYLSGPER
ADLAASLKLTETQVKIWFQNRRYKTKRRQMAADLL
ASAPAAKKVAVKVLVRDDQRQYLPGEVLRPPSLLP
LQPSYYYPYY
Storage
-20C
Provider Type Product Number
- No reagents -