H00022862-B01P

FNDC3A antibody from Abnova Corporation
bA203I16.5, FNDC3, KIAA0970

Antibody data

Product number
H00022862-B01P
Provider
Abnova Corporation
Product name
FNDC3A purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00022862-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human FNDC3A protein.
Antigen sequence
MMSPNGSVPPIYVPPGYAPQVIEDNGVRRVVVVPQ
APEFHPGSHTVLHRSPHPPLPGFIPVPTMMPPPPR
HMYSPVTGAGDMTTQYMPQYQSSQVYGDVDAHSTH
GRSNFRDERSSKTYERLQKKLKDRQGTQKDKMSSP
PSSPQKCPSPINEHNGLIKGQIAGGINTGSAKIKS
GKGKGGTQVDTEIEEKDEETKAFEALLSNIVKPVA
SDIQARTVVLTWSPPSSLINGETDESSVPELYGYE
VLISSTGKDGKYKSVYVGEETNITLNDLKPAMDYH
AKVQAEYNSIKGTPSEAEIFTTLSCEPDIPNPPRI
ANRTKNSLTLQWKAPSDNGSKIQNFVLEWDEGKGN
GEFCQCYMGSQKQFKITKLSPAMGCKFRLSARNDY
GTSGFSEEVLYYTSGCAPSMPASPVLTKAGITWLS
LQWSKPSGTPSDEGISYILEMEEETSGYGFKPKYD
GEDLAYTVKNLRRSTKYKFKVIAYNSEGKSNPSEV
VEFTTCPDKPGIPVKPSVKGKIHSHSFKITWDPPK
DNGGATINKYVVEMAEGSNGNKWEMIYSGATREHL
CDRLNPGCFYRLRVYCISDGGQSAVSESLLVQTPA
VPPGPCLPPRLQGRPKAKEIQLRWGPPLVDGGSPI
SCYSVEMSPIEKDEPREVYQGSEVECTVSSLLPGK
TYSFRLRAANKMGFGPFSEKCDITTAPGPPDQCKP
PQVTCRSATCAQVNWEVPLSNGTDVTEYRLEWGGV
EGSMQICYCGPGLSYEIKGLSPATTYYCRVQALSV
VGAGPFSEVVACVTPPSVPGIVTCLQEISDDEIEN
PHYSPSTCLAISWEKPCDHGSEILAYSIDFGDKQS
LTVGKVTSYIINNLQPDTTYRIRIQALNSLGAGPF
SHMIKLKTKPLPPDPPRLECVAFSHQNLKLKWGEG
TPKTLSTDSIQYHLQMEDKNGRFVSLYRGPCHTYK
VQRLNESTSYKFCIQACNEAGEGPLSQEYIFTTPK
SVPAALKAPKIEKVNDHICEITWECLQPMKGDPVI
YSLQVMLGKDSEFKQIYKGPDSSFRYSSLQLNCEY
RFRVCAIRQCQDSLGHQDLVGPYSTTVLFISQRTE
PPASTNRDTVESTRTRRALSDEQCAAVILVLFAFF
SILIAFIIQYFVIK
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -