Antibody data

Product number
H00022862-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00022862-M01, RRID:AB_606257
Product name
FNDC3A monoclonal antibody (M01), clone 2H4
Provider product page
Abnova Corporation - H00022862-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant FNDC3A.
Antigen sequence
DPVIYSLQVMLGKDSEFKQIYKGPDSSFRYSSLQL
NCEYRFRVCAIRQCQDSLGHQDLVGPYSTTVLFIS
QRTEPPASTNRDTVESTRTRRALSDEQCA
Isotype
IgG
Antibody clone number
2H4
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -