HPA008927

FNDC3A antibody from Atlas Antibodies
bA203I16.5, FNDC3, KIAA0970
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA008927
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA008927, RRID:AB_1078899
Product name
Anti-FNDC3A
Provider product page
Atlas Antibodies - HPA008927
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
GAGDMTTQYMPQYQSSQVYGDVDAHSTHGRSNFRD
ERSSKTYERLQKKLKDRQGTQKDKMSSPPSSPQKC
PSPINEHNGLIKGQIAGGINTGSAKIKSGKGKGGT
QVDTEIEEKDEETKAFEALLSNIVKPVA
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -