HPA012825

FNDC3A antibody from Sigma-Aldrich
bA203I16.5, FNDC3, KIAA0970
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA012825
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA012825, RRID:AB_1848985
Product name
Anti-FNDC3A antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA012825
Antibody type
Polyclonal
Antigen
Fibronectin type-III domain-containing protein 3a recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VNWEVPLSNGTDVTEYRLEWGGVEGSMQICYCGPG
LSYEIKGLSPATTYYCRVQALSVVGAGPFSEVVAC
VTPPSVPGIVTCLQEISDDEIENPHYSPSTCLAIS
WEKPCDHGSEILAYSIDFGDKQSLTVGKV
Storage
-20C
Provider Type Product Number
- No reagents -