Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN184090 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Cytoplasmic Polyadenylation Element Binding Protein 2 (CPEB2) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-CPEB2 antibody: synthetic peptide directed towards the middle region of human CPEB2
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Porcine, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
DTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQ
HGDID KRVEVKPYVL- Epitope
- Middle Region
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references CPEB2, a novel putative translational regulator in mouse haploid germ cells.
Kurihara Y, Tokuriki M, Myojin R, Hori T, Kuroiwa A, Matsuda Y, Sakurai T, Kimura M, Hecht NB, Uesugi S
Biology of reproduction 2003 Jul;69(1):261-8
Biology of reproduction 2003 Jul;69(1):261-8
No comments: Submit comment
No validations: Submit validation data