Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00006507-M07A - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00006507-M07A, RRID:AB_1204982
- Product name
- SLC1A3 monoclonal antibody (M07A), clone 3D1
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant SLC1A3.
- Antigen sequence
VRVTAADAFLDLIRNMFPPNLVEACFKQFKTNYEK
RSFKVPIQANETLVGAVINNVSEAMETLTRITEEL
VPVPGS- Isotype
- IgM
- Antibody clone number
- 3D1
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Involvement of crosstalk between Oct4 and Meis1a in neural cell fate decision.
Yamada T, Urano-Tashiro Y, Tanaka S, Akiyama H, Tashiro F
PloS one 2013;8(2):e56997
PloS one 2013;8(2):e56997
No comments: Submit comment
No validations: Submit validation data