H00006507-M07A

SLC1A3 antibody from Abnova Corporation
EA6, EAAT1, GLAST
No application information provided.

Antibody data

Product number
H00006507-M07A
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00006507-M07A, RRID:AB_1204982
Product name
SLC1A3 monoclonal antibody (M07A), clone 3D1
Provider product page
Abnova Corporation - H00006507-M07A
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant SLC1A3.
Antigen sequence
VRVTAADAFLDLIRNMFPPNLVEACFKQFKTNYEK
RSFKVPIQANETLVGAVINNVSEAMETLTRITEEL
VPVPGS
Isotype
IgM
Antibody clone number
3D1
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -