HPA003552

STXBP6 antibody from Sigma-Aldrich
amisyn, HSPC156
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003552
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003552, RRID:AB_10603343
Product name
Anti-STXBP6 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003552
Antibody type
Polyclonal
Antigen
syntaxin binding protein 6 (amisyn) recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NKKPTQASITKVKQFEGSTSFVRRSQWMLEQLRQV
NGIDPNGDSAEFDLLFENAFDQWVASTASEKCTFF
QILHHTCQRYLTDRKPEFINCQSKIMGGNSILHSA
ADSVTSAVQKASQALNERGERLGRAEEKTEDLK
Storage
-20C
Provider Type Product Number
- No reagents -