Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00009992-A01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00009992-A01, RRID:AB_627510
- Product name
- KCNE2 polyclonal antibody (A01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a partial recombinant KCNE2.
- Antigen sequence
KSKRREHSNDPYHQYIVEDWQEKYKSQILNLEESK
ATIHENIGAAGFKMSP- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Differential regulation of HCN channel isoform expression in thalamic neurons of epileptic and non-epileptic rat strains.
Kanyshkova T, Meuth P, Bista P, Liu Z, Ehling P, Caputi L, Doengi M, Chetkovich DM, Pape HC, Budde T
Neurobiology of disease 2012 Jan;45(1):450-61
Neurobiology of disease 2012 Jan;45(1):450-61
No comments: Submit comment
No validations: Submit validation data