HPA028084

ALPK2 antibody from Sigma-Aldrich
HAK
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA028084
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA028084, RRID:AB_10601996
Product name
Anti-ALPK2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA028084
Antibody type
Polyclonal
Antigen
alpha-kinase 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EKPTTLTANNECFQATRETEDTSTVTIATEVHPAK
YLAVSIPEDKHAGGTEERFPRASHEKVSQFPSQVQ
VDHILSGATIKSTKELLCRAPSVPGVP
Storage
-20C
Provider Type Product Number
- No reagents -