HPA012800

PLD3 antibody from Sigma-Aldrich
HU-K4
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA012800
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA012800, RRID:AB_1855330
Product name
Anti-PLD3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA012800
Antibody type
Polyclonal
Antigen
Phospholipase D3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LDFPNASTGNPSTSQAWLGLLAGAHSSLDIASFYW
TLTNNDTHTQEPSAQQGEEVLRQLQTLAPKGVNVR
IAVSKPSGPQPQADLQALLQSGAQVRMVDMQKLTH
GVLHTKFWVVDQTHFYLGSAN
Storage
-20C
Provider Type Product Number
- No reagents -