Antibody data

Product number
HPA012800
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA012800, RRID:AB_1855330
Product name
Anti-PLD3
Provider product page
Atlas Antibodies - HPA012800
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LDFPNASTGNPSTSQAWLGLLAGAHSSLDIASFYW
TLTNNDTHTQEPSAQQGEEVLRQLQTLAPKGVNVR
IAVSKPSGPQPQADLQALLQSGAQVRMVDMQKLTH
GVLHTKFWVVDQTHFYLGSAN
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.