Antibody data
- Product number
- HPA012800
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA012800, RRID:AB_1855330
- Product name
- Anti-PLD3
- Provider product page
- Atlas Antibodies - HPA012800
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
LDFPNASTGNPSTSQAWLGLLAGAHSSLDIASFYW
TLTNNDTHTQEPSAQQGEEVLRQLQTLAPKGVNVR
IAVSKPSGPQPQADLQALLQSGAQVRMVDMQKLTH
GVLHTKFWVVDQTHFYLGSAN
- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Western blot analysis in human cell line SH-SY5Y.
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells and glial cells.
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human cerebral cortex shows moderate to strong granular cytoplasmic positivity in neurons.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human rectum shows strong cytoplasmic positivity in lymphoid cells.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human pancreas shows moderate granular cytoplasmic positivity in islets of Langerhans.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human skeletal muscle shows no granular cytoplasmic positivity in striated muscle fibers as expected.
- Sample type
- HUMAN
Enhanced validation
- Submitted by
-
Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image

- Experimental details
- Immunohistochemistry analysis in human cerebral cortex and skeletal muscle tissues using HPA012800 antibody. Corresponding PLD3 RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
- Orthogonal method
- Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
- Show more