Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00003753-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00003753-M01, RRID:AB_565896
- Product name
- KCNE1 monoclonal antibody (M01), clone 5B12
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant KCNE1.
- Antigen sequence
RSKKLEHSNDPFNVYIESDAWQEKDKAYVQARVLE
SYRSCYVVENHLAIEQPNTHLPETKPSP- Isotype
- IgG
- Antibody clone number
- 5B12
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references [Ca2+]i elevation and oxidative stress induce KCNQ1 protein translocation from the cytosol to the cell surface and increase slow delayed rectifier (IKs) in cardiac myocytes.
Wang Y, Zankov DP, Jiang M, Zhang M, Henderson SC, Tseng GN
The Journal of biological chemistry 2013 Dec 6;288(49):35358-71
The Journal of biological chemistry 2013 Dec 6;288(49):35358-71
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged KCNE1 is approximately 3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol