Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00008175-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00008175-M01, RRID:AB_566175
- Product name
- SF3A2 monoclonal antibody (M01), clone 3B6
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant SF3A2.
- Antigen sequence
IGRPGYKVTKQRDSEMGQQSLLFQIDYPEIAEGIM
PRHRFMSAYEQRIEPPDRRWQYLLMAAEPYETIAF
KVPSREIDKAEGKFWTHWNRETKQFFLQFHFKMEK- Isotype
- IgG
- Antibody clone number
- 3B6
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Global tumor protein p53/p63 interactome: making a case for cisplatin chemoresistance.
Huang Y, Jeong JS, Okamura J, Sook-Kim M, Zhu H, Guerrero-Preston R, Ratovitski EA
Cell cycle (Georgetown, Tex.) 2012 Jun 15;11(12):2367-79
Cell cycle (Georgetown, Tex.) 2012 Jun 15;11(12):2367-79
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to SF3A2 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol