Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00001827-M03 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00001827-M03, RRID:AB_875544
- Product name
- DSCR1 monoclonal antibody (M03), clone 1B1
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant DSCR1.
- Antigen sequence
MEEVDLQDLPSATIACHLDPRVFVDGLCRAKFESL
FRTYDKDITFQYFKSFKRVRINFSNPFSAADARLQ
LHKTEFLGKEMKLYFAQTLHIGSSHLAPPN- Isotype
- IgG
- Antibody clone number
- 1B1
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Creation and characterization of BAC-transgenic mice with physiological overexpression of epitope-tagged RCAN1 (DSCR1).
Xing L, Salas M, Zhang H, Gittler J, Ludwig T, Lin CS, Murty VV, Silverman W, Arancio O, Tycko B
Mammalian genome : official journal of the International Mammalian Genome Society 2013 Feb;24(1-2):30-43
Mammalian genome : official journal of the International Mammalian Genome Society 2013 Feb;24(1-2):30-43
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged DSCR1 is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to RCAN1 on HeLa cell . [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol