Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- PAB20625 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#PAB20625, RRID:AB_10968289
- Product name
- CEACAM4 polyclonal antibody
- Antibody type
- Polyclonal
- Antigen
- Recombinant protein corresponding to amino acids of human CEACAM4.
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
QFTIEALPSSAAEGKDVLLLACNISETIQAYYWHK
GKTAEGSPLIAGYITDIQANIPGAAYSGRETVYPN
GSLLFQNITLEDAGSYTLRTINASYDSDQATGQLH
VHQNNVPGLPV- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western blot analysis of Lane 1: Negative control (vector only transfected HEK293T lysate).Lane 2: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells with CEACAM4 polyclonal antibody (Cat # PAB20625).
- Validation comment
- Western Blot (Transfected lysate)
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human duodenum with CEACAM4 polyclonal antibody (Cat # PAB20625) shows strong membranous positivity in glandular cells at 1:20-1:50 dilution.
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)