HPA012801

CEACAM4 antibody from Sigma-Aldrich
CGM7
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA012801
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA012801, RRID:AB_1846489
Product name
Anti-CEACAM4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA012801
Antibody type
Polyclonal
Antigen
Carcinoembryonic antigen-related cell adhesion molecule 4 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QFTIEALPSSAAEGKDVLLLACNISETIQAYYWHK
GKTAEGSPLIAGYITDIQANIPGAAYSGRETVYPN
GSLLFQNITLEDAGSYTLRTINASYDSDQATGQLH
VHQNNVPGLPV
Storage
-20C
Provider Type Product Number
- No reagents -