Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA045695 - Provider product page
- Provider
- Atlas Antibodies
- Product name
- Anti-DPPA3
- Antibody type
- Polyclonal
- Antigen
- Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
RGVRTLLSVQREKMARLRYMLLGGVRTHERRPTNK
EPKGVKKESRPFKCPCSFCVSNGWDPSENARIENQ
DTKPLQP- Isotype
- IgG
- Vial size
- 100μl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Tankyrase inhibition promotes a stable human naïve pluripotent state with improved functionality
Zimmerlin L, Park T, Huo J, Verma K, Pather S, Talbot C, Agarwal J, Steppan D, Zhang Y, Considine M, Guo H, Zhong X, Gutierrez C, Cope L, Canto-Soler M, Friedman A, Baylin S, Zambidis E
Development 2016;143(23):4368-4380
Development 2016;143(23):4368-4380
No comments: Submit comment
No validations: Submit validation data