PAB21982

SEC11C antibody from Abnova Corporation
SEC11L3, SPC21, SPCS4C

Antibody data

Product number
PAB21982
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB21982, RRID:AB_10964976
Product name
SEC11C polyclonal antibody
Provider product page
Abnova Corporation - PAB21982
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant SEC11C.
Antigen sequence
MVRAGAVGAHLPASGLDIFGDLKKMNKRQLYYQV
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -