HPA012556

SIGLEC8 antibody from Sigma-Aldrich
MGC59785, SAF2, SIGLEC-8, SIGLEC8L
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA012556
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA012556, RRID:AB_1856869
Product name
Anti-Siglec-8 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA012556
Antibody type
Polyclonal
Antigen
Sialic acid-binding Ig-like lectin 8 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RSCRKKSARPAAGVGDTGMEDAKAIRGSASQGPLT
ESWKDGNPLKKPPPAVAPSSGEEGELHYATLSFHK
VKPQDPQGQEATDSEYSEIKIHKRETAETQACLRN
HNPSSKEVRG
Storage
-20C
Provider Type Product Number
- No reagents -