HPA012556

SIGLEC8 antibody from Atlas Antibodies
MGC59785, SAF2, SIGLEC-8, SIGLEC8L
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA012556
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA012556, RRID:AB_1856869
Product name
Anti-SIGLEC8
Provider product page
Atlas Antibodies - HPA012556
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
RSCRKKSARPAAGVGDTGMEDAKAIRGSASQGPLT
ESWKDGNPLKKPPPAVAPSSGEEGELHYATLSFHK
VKPQDPQGQEATDSEYSEIKIHKRETAETQACLRN
HNPSSKEVRG
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -