HPA008943

ICAM5 antibody from Sigma-Aldrich
TLCN, TLN
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008943
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008943, RRID:AB_1079095
Product name
Anti-ICAM5 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008943
Antibody type
Polyclonal
Antigen
Intercellular adhesion molecule 5 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VRSGELGAVIEGLLRVAREHAGTYRCEATNPRGSA
AKNVAVTVEYGPRFEEPSCPSNWTWVEGSGRLFSC
EVDGKPQPSVKCVGSGGATEGVLLPLAPPDPSPRA
PRIPRVLAPGIYVCNATNRHGSVAKTVVVS
Storage
-20C
Provider Type Product Number
- No reagents -