Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [6]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA041374 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA041374, RRID:AB_10794515
- Product name
- Anti-CCBE1
- Antibody type
- Polyclonal
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
PGSFDFLLLMLADIRNDITELQEKVFGHRTHSSAE
EFPLPQEFPSYPEAMDLGSGDDHPRRTETRDLRA- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references The YAP-TEAD4 complex promotes tumor lymphangiogenesis by transcriptionally upregulating CCBE1 in colorectal cancer.
CCBE1 promotes tumor lymphangiogenesis and is negatively regulated by TGFβ signaling in colorectal cancer.
KLK3/PSA and cathepsin D activate VEGF-C and VEGF-D.
Efficient activation of the lymphangiogenic growth factor VEGF-C requires the C-terminal domain of VEGF-C and the N-terminal domain of CCBE1.
CCBE1 promotes GIST development through enhancing angiogenesis and mediating resistance to imatinib
A Multiplex Kindred with Hennekam Syndrome due to Homozygosity for a CCBE1 Mutation that does not Prevent Protein Expression.
Song J, Dang X, Shen X, Liu Y, Gu J, Peng X, Huang Z, Hong W, Cui L, Liu CY
The Journal of biological chemistry 2023 Apr;299(4):103012
The Journal of biological chemistry 2023 Apr;299(4):103012
CCBE1 promotes tumor lymphangiogenesis and is negatively regulated by TGFβ signaling in colorectal cancer.
Song J, Chen W, Cui X, Huang Z, Wen D, Yang Y, Yu W, Cui L, Liu CY
Theranostics 2020;10(5):2327-2341
Theranostics 2020;10(5):2327-2341
KLK3/PSA and cathepsin D activate VEGF-C and VEGF-D.
Jha SK, Rauniyar K, Chronowska E, Mattonet K, Maina EW, Koistinen H, Stenman UH, Alitalo K, Jeltsch M
eLife 2019 May 17;8
eLife 2019 May 17;8
Efficient activation of the lymphangiogenic growth factor VEGF-C requires the C-terminal domain of VEGF-C and the N-terminal domain of CCBE1.
Jha SK, Rauniyar K, Karpanen T, Leppänen VM, Brouillard P, Vikkula M, Alitalo K, Jeltsch M
Scientific reports 2017 Jul 7;7(1):4916
Scientific reports 2017 Jul 7;7(1):4916
CCBE1 promotes GIST development through enhancing angiogenesis and mediating resistance to imatinib
Tian G, Zhu C, Zhang X, Zhu L, Yang X, Jiang S, Li R, Tu L, Wang Y, Zhuang C, He P, Li Q, Cao X, Cao H, Zhang Z
Scientific Reports 2016;6(1)
Scientific Reports 2016;6(1)
A Multiplex Kindred with Hennekam Syndrome due to Homozygosity for a CCBE1 Mutation that does not Prevent Protein Expression.
Jackson CC, Best L, Lorenzo L, Casanova JL, Wacker J, Bertz S, Agaimy A, Harrer T
Journal of clinical immunology 2016 Jan;36(1):19-27
Journal of clinical immunology 2016 Jan;36(1):19-27
No comments: Submit comment
No validations: Submit validation data