H00147372-D01

CCBE1 antibody from Abnova Corporation
FLJ30681, KIAA1983

Antibody data

Product number
H00147372-D01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00147372-D01, RRID:AB_10719488
Product name
CCBE1 MaxPab rabbit polyclonal antibody (D01)
Provider product page
Abnova Corporation - H00147372-D01
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against a full-length human CCBE1 protein.
Antigen sequence
MVKAGTCCATCKEFYQMKQTVLQLKQKIALLPNNA
ADLGKYITGDKVLASNTYLPGPPGLPGGQGPPGSP
GPKGSPGFPGMPGPPGQPGPRGSMGPMGPSPDLSH
IKQGRRGPVGPPGAPGRDGSKGERGAPGPRGSPGP
PGSFDFLLLMLADIRNDITELQEKVFGHRTHSSAE
EFPLPQEFPSYPEAMDLGSGDDHPRRTETRDLRAP
RDFYP
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.