H00000683-A01

BST1 antibody from Abnova Corporation
CD157
No application information provided.

Antibody data

Product number
H00000683-A01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00000683-A01, RRID:AB_1139187
Product name
BST1 polyclonal antibody (A01)
Provider product page
Abnova Corporation - H00000683-A01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length recombinant BST1.
Antigen sequence
MAAQGCAASRLLQLLLQLLLLLLLLAAGGARARWR
GEGTSAHLRDIFLGRCAEYRALLSPEQRNKNCTAI
WEAFKVALDKDPCSVLPSDYDLFINLSRHSIPRDK
SLFWENSHLLVNSFADNTRRFMPLSDVLYGRVADF
LSWCRQKNDSGLDYQSCPTSEDCENNPVDSFWKRA
SIQYSKDSSGVIHVMLNGSEPTGAYPIKGFFADYE
IPNLQKEKITRIEIWVMHEIGGPNVESCGEGSMKV
LEKRLKDMGFQYSCINDYRPVKLLQCVDHSTHPDC
ALKSAAAATQRKAPSLYTEQRAGLIIPLFLVLASR
TQL
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -