HPA012844

ZNRF4 antibody from Sigma-Aldrich
RNF204, spzn, Ssrzf1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA012844
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA012844, RRID:AB_1859482
Product name
Anti-ZNRF4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA012844
Antibody type
Polyclonal
Antigen
Zinc/RING finger protein 4 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
CLDEYEEGDQLKILPCSHTYHCKCIDPWFSQAPRR
SCPVCKQSVAATEDSFDSTTYSFRDEDPSLPGHRP
PIWAIQVQLRSRRLELLGRASPHCHCSTTSLEAEY
TTVSSAP
Storage
-20C
Provider Type Product Number
- No reagents -