HPA060458

TPSG1 antibody from Atlas Antibodies
PRSS31, TMT

Antibody data

Product number
HPA060458
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA060458, RRID:AB_2684283
Product name
Anti-TPSG1
Provider product page
Atlas Antibodies - HPA060458
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
PYSLREVKVSVVDTETCRRDYPGPGGSILQPDMLC
AR
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.