H00001690-B01P

COCH antibody from Abnova Corporation
COCH-5B2, DFNA31, DFNA9

Antibody data

Product number
H00001690-B01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00001690-B01P, RRID:AB_1673254
Product name
COCH purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00001690-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human COCH protein.
Antigen sequence
MSAAWIPALGLGVCLLLLPGPAGSEGAAPIAITCF
TRGLDIRKEKADVLCPGGCPLEEFSVYGNIVYASV
SSICGAAVHRGVISNSGGPVRVYSLPGRENYSSVD
ANGIQSQMLSRWSASFTVTKGKSSTQEATGQAVST
AHPPTGKRLKKTPEKKTGNKDCKADIAFLIDGSFN
IGQRRFNLQKNFVGKVALMLGIGTEGPHVGLVQAS
EHPKIEFYLKNFTSAKDVLFAIKEVGFRGGNSNTG
KALKHTAQKFFTVDAGVRKGIPKVVVVFIDGWPSD
DIEEAGIVAREFGVNVFIVSVAKPIPEELGMVQDV
TFVDKAVCRNNGFFSYHMPNWFGTTKYVKPLVQKL
CTHEQMMCSKTCYNSVNIAFLIDGSSSVGDSNFRL
MLEFVSNIAKTFEISDIGAKIAAVQFTYDQRTEFS
FTDYSTKENVLAVIRNIRYMSGGTATGDAISFTVR
NVFGPIRESPNKNFLVIVTDGQSYDDVQGPAAAAH
DAAK
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.